Analytical Data
-
Gene name
VACWR025
- Application
-
Alternative Names
VACWR025;
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P68638
-
Expression Region
20-263aa
-
AA Sequence
CCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFKCKYGYKLSGSSSSTCSPGNTWKPELPKCVR
-
Molecular Weight
28.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VACWR025 is a recombinant protein derived from the Vaccinia virus, which is known for its potential applications in both basic research and therapeutic development. The significance of VACWR025 lies in its immunogenic properties, as it appears to play a critical role in modulating the immune response. Researchers have been investigating the functional domains of VACWR025 to understand how it interacts with the host immune system, particularly its ability to evade immune detection and promote viral survival. In addition, VACWR025 has garnered interest in the realm of vaccine development and cancer immunotherapy, where its unique properties could be leveraged to enhance the efficacy of existing treatments. The study of this recombinant protein is not only crucial for elucidating the mechanisms of Vaccinia virus pathogenesis but also for exploring novel strategies in vaccine design and immunotherapy. By harnessing the findings related to VACWR025, scientists aim to develop innovative therapeutic approaches that can boost the immune response against various pathogens and tumors, thereby contributing to the broader fields of virology and immunology.











