Analytical Data
-
Gene name
AVPR2
- Application
-
Alternative Names
AVPR2；ADHR；DIR；DIR3；Vasopressin V2 receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P30518
-
Expression Region
1-371aa
-
AA Sequence
MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLAALARRGRRGHWAPIHVFIGHLCLADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQMVGMYASSYMILAMTLDRHRAICRPMLAYRHGSGAHWNRPVLVAWAFSLLLSLPQLFIFAQRNVEGGSGVTDCWACFAEPWGRRTYVTWIALMVFVAPTLGIAACQVLIFREIHASLVPGPSERPGGRRRGRRTGSPGEGAHVSAAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEAPLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTTASSSLAKDTSS
-
Molecular Weight
40.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The AVPR2 (arginine vasopressin receptor 2) is a G protein-coupled receptor that plays a crucial role in water homeostasis and the regulation of blood pressure. It is primarily expressed in the kidneys, where it mediates the effects of arginine vasopressin (AVP), a hormone that promotes water reabsorption and concentrates urine. Dysfunctions or mutations in the AVPR2 gene are associated with nephrogenic diabetes insipidus, a condition characterized by the inability of the kidneys to concentrate urine, leading to excessive urination and thirst. Given its significant physiological roles and implications in related diseases, there has been increasing interest in the study of AVPR2. The development of recombinant AVPR2 proteins aids in understanding its molecular structure, signaling pathways, and interactions with ligands. Research on AVPR2 can potentially facilitate the discovery of therapeutic targets for treating related disorders, as well as provide insights into the receptor's mechanism of action within various physiological contexts. The production of AVPR2 in a recombinant form allows for detailed characterization, including binding studies and functional assays, which are essential for drug discovery and development. Therefore, the study of AVPR2 recombinant proteins is integral to advancing our understanding of renal physiology and the potential to address conditions associated with AVPR2 dysfunction.
