Analytical Data
-
Gene name
EMCN
- Application
-
Alternative Names
EMCN；EMCN2；MUC14;Endomucin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9ULC0
-
Expression Region
1-261aa
-
AA Sequence
MELLQVTILFLLPSICSSNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTTEIPGSVLQPDASPSKTGTLTSIPVTIPENTSQSQVIGTEGGKNASTSATSRSYSSIILPVVIALIVITLSVFVLVGLYRMCWKADPGTPENGNDQPQSDKESVKLLTVKTISHESGEHSAQGKTKN
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EMCN, or Endothelial Glycocalyx Layer Component, is a heparan sulfate proteoglycan predominantly expressed in endothelial cells, playing a crucial role in vascular biology and homeostasis. Research into EMCN has gained momentum due to its association with various physiological and pathological processes, including angiogenesis, inflammation, and tumor progression. The protein is instrumental in mediating cell adhesion, regulating vascular permeability, and influencing the interaction between endothelial cells and circulating immune cells. Dysregulation of EMCN expression or function has been implicated in several cardiovascular diseases, including atherosclerosis and hypertension, as well as in cancer metastasis. Consequently, EMCN is emerging as a potential biomarker for these conditions and a targeted therapeutic avenue. Understanding its structural properties and signaling pathways can provide insights into its functional roles, offering new possibilities for intervention strategies in diseases associated with endothelial dysfunction. Current research focuses on characterizing EMCN through recombinant protein technologies to explore its molecular mechanisms and potential applications in regenerative medicine and targeted therapies.
