Analytical Data
-
Gene name
TM4SF1
- Application
-
Alternative Names
TM4SF1；SITAC18；Syntenin-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P30408
-
Expression Region
1-202aa
-
AA Sequence
MCYGKCARCIGHSLVGLALLCIAANILLYFPNGETKYASENHLSRFVWFF SGIVGGGLLMLLPAFVFIGLEQDDCCGCCGHENCGKRCAMLSSVLAALIG IAGSGYCVIVAALGLAEGPLCLDSLGQWNYTFASTEGQYLLDTSTWSECT EPKHIVEWNVSLFSILLALGGIEFILCLIQVINGVLGGICGFCCSHQQQY DC
-
Molecular Weight
22 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TM4SF1 (Transmembrane 4 L6 Superfamily Member 1) is a member of the tetraspanin family, which plays a vital role in various cellular processes, including cell adhesion, proliferation, and signal transduction. Found predominantly in immune cells and cancer tissues, TM4SF1 has garnered attention due to its involvement in tumor progression and metastasis. Studies have shown that TM4SF1 is upregulated in several cancers, suggesting it may serve as a potential biomarker for tumor diagnosis and prognosis. Researchers are particularly interested in its role in modulating cell-microenvironment interactions and influencing immune responses. The recombinant expression of TM4SF1 protein has become a focus of scientific investigations, enabling the exploration of its structure, function, and potential applications in cancer immunotherapy. By utilizing techniques such as genetic engineering and protein purification, scientists aim to produce functional TM4SF1 for detailed biochemical studies. Understanding how TM4SF1 mediates its effects at a molecular level could provide insights into targeted therapies, enhancing treatment options for cancer patients. Furthermore, the potential use of TM4SF1 in designing novel therapeutic agents underscores the importance of continued research in this area. Overall, the study of TM4SF1 as a recombinant protein not only sheds light on its biological significance but also paves the way for innovative strategies in cancer treatment and diagnostics.
