Cat: PA2000-3749

Recombinant Human TM4SF1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TM4SF1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TM4SF1;SITAC18;Syntenin-2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P30408

  • Expression Region

    1-202aa

  • AA Sequence

    MCYGKCARCIGHSLVGLALLCIAANILLYFPNGETKYASENHLSRFVWFF SGIVGGGLLMLLPAFVFIGLEQDDCCGCCGHENCGKRCAMLSSVLAALIG IAGSGYCVIVAALGLAEGPLCLDSLGQWNYTFASTEGQYLLDTSTWSECT EPKHIVEWNVSLFSILLALGGIEFILCLIQVINGVLGGICGFCCSHQQQY DC

  • Molecular Weight

    22 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TM4SF1 (Transmembrane 4 L6 Superfamily Member 1) is a member of the tetraspanin family, which plays a vital role in various cellular processes, including cell adhesion, proliferation, and signal transduction. Found predominantly in immune cells and cancer tissues, TM4SF1 has garnered attention due to its involvement in tumor progression and metastasis. Studies have shown that TM4SF1 is upregulated in several cancers, suggesting it may serve as a potential biomarker for tumor diagnosis and prognosis. Researchers are particularly interested in its role in modulating cell-microenvironment interactions and influencing immune responses. The recombinant expression of TM4SF1 protein has become a focus of scientific investigations, enabling the exploration of its structure, function, and potential applications in cancer immunotherapy. By utilizing techniques such as genetic engineering and protein purification, scientists aim to produce functional TM4SF1 for detailed biochemical studies. Understanding how TM4SF1 mediates its effects at a molecular level could provide insights into targeted therapies, enhancing treatment options for cancer patients. Furthermore, the potential use of TM4SF1 in designing novel therapeutic agents underscores the importance of continued research in this area. Overall, the study of TM4SF1 as a recombinant protein not only sheds light on its biological significance but also paves the way for innovative strategies in cancer treatment and diagnostics.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US