Analytical Data
-
Gene name
GNG10
- Application
-
Alternative Names
GBG10_HUMAN; GNG10; Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P50151
-
Expression Region
1-68aa
-
AA Sequence
MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALL
-
Molecular Weight
33.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GNG10, a member of the G-protein gamma subunit family, plays a crucial role in signal transduction pathways, mediating various physiological processes by interacting with G-protein coupled receptors (GPCRs). Research into GNG10 has gained momentum due to its implications in numerous biological functions, including neurotransmission, immune response, and cellular communication. Aberrant expression or dysfunction of GNG10 has been linked to several diseases, particularly neurological disorders and cancer, highlighting its potential as a therapeutic target. The recombinant expression of GNG10 provides a valuable tool for understanding its structural and functional properties, enabling detailed investigations of its interactions and signaling mechanisms. Moreover, studying recombinant GNG10 can enhance our comprehension of its role in molecular pathways and facilitate the development of drugs aimed at modulating its activity for therapeutic benefits. Advances in recombinant DNA technology have significantly improved the ability to produce GNG10 in vitro, paving the way for high-throughput screening of compounds that can influence its function and signaling outcomes. Furthermore, characterizing GNG10 through crystallography or cryo-electron microscopy can provide insights into its three-dimensional structure, revealing potential binding sites for ligands and aiding in rational drug design. As research continues to unravel the complexities of GNG10-mediated signaling, it holds promise not only for basic biological understanding but also for innovative therapeutic strategies aimed at diseases linked to its dysregulation. Thus, GNG10 recombinant proteins are crucial for advancing our knowledge in the field of G-protein signaling and contributing to the development of targeted treatments.
