Analytical Data
-
Gene name
EIF3K
- Application
-
Alternative Names
EIF3K；EIF3S12;Eukaryotic translation initiation factor 3 subunit K
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UBQ5
-
Expression Region
1-218aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMAMFEQMRANVGKLLKGIDRYNPENLATLE RYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHT DFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEG ITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWS ADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EIF3K, a subunit of the eukaryotic translation initiation factor 3 (eIF3), plays a crucial role in the initiation of protein synthesis by facilitating the binding of the ribosome to mRNA and assisting in the recruitment of tRNA. The study of EIF3K is particularly relevant due to its involvement in various cellular processes, including cell growth, division, and response to stress. Recent research has highlighted its potential role in cancer biology, as altered EIF3K expression can influence tumorigenesis and cancer progression. Moreover, EIF3K has been implicated in several other diseases, emphasizing the need for detailed studies on its structure and function. Recombinant EIF3K protein has become a valuable tool for understanding its mechanistic roles and interactions at the molecular level. By producing and analyzing this protein in a controlled environment, researchers can explore its binding partners and regulatory pathways, which could lead to novel therapeutic strategies. Efforts to elucidate the specific functions and interactions of EIF3K may pave the way for its utilization in targeted therapies, especially in cancers where its expression is dysregulated. Consequently, the recombination and functional characterization of EIF3K protein hold significant promise in advancing our understanding of translation initiation and its implications in health and disease.
