Analytical Data
-
Gene name
Robo1
- Application
-
Alternative Names
Robo1;DUTT1;Roundabout homolog 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y6N7
-
Expression Region
491-589aa
-
AA Sequence
DGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYI EVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQPNLNSGA
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Robo1, a member of the Roundabout (Robo) family of receptors, plays a crucial role in various developmental processes, including axon guidance and synaptic plasticity. Initially identified for its function in neural development, Robo1 is known to interact with its ligands, the Slits, to mediate repulsive signaling that guides neuronal growth cones away from inappropriate pathways. In addition to its neurological functions, emerging research has indicated that Robo1 is involved in other biological processes, such as cell migration, tissue repair, and potentially the modulation of immune responses. Given its diverse roles, Robo1 has garnered interest for its implications in various pathological conditions, including cancer metastasis, where its expression levels may influence tumor progression and invasiveness. Understanding the structural and functional properties of Robo1 through recombinant protein studies is essential for elucidating its mechanisms of action and potential therapeutic applications. By generating recombinant Robo1 proteins, researchers aim to perform detailed biochemical analyses, including ligand-binding assays and signaling pathway activation studies, which could illuminate its role in development and disease. Additionally, the development of Robo1-targeting therapeutics could provide novel strategies for treating diseases in which Robo1 dysfunction is implicated. Overall, the study of Robo1 and its recombinant proteins is a vital area of research that bridges developmental biology, neuroscience, and cancer biology, offering insights into both fundamental biological processes and potential clinical applications.











