Analytical Data
-
Gene name
CLCA1
- Application
-
Alternative Names
CLCA1；CACC1；Calcium-activated chloride channel regulator 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A8K7I4
-
Expression Region
677-776aa
-
AA Sequence
ALGGVNAARRRVIPQQSGALYIPGWIENDEIQWNPPRPEINKDDVQHKQV CFSRTSSGGSFVASDVPNAPIPDLFPPGQITDLKAEIHGGSLINLTWTAP
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CLCA1 (Chloride Channel Accessory 1) is a member of the CLCA protein family that is primarily involved in regulating chloride ion channels and modulating epithelial functions, particularly in respiratory and intestinal tissues. Recent studies have highlighted its role in physiological processes such as mucus secretion and ion transport, making it a critical player in maintaining epithelial homeostasis. Dysregulation of CLCA1 has been associated with various pathological conditions, including asthma, cystic fibrosis, and other respiratory diseases, prompting researchers to investigate its potential as a therapeutic target. The production of recombinant CLCA1 protein through molecular cloning techniques has enabled detailed studies of its structure and function. This has allowed for the elucidation of its interactions with other proteins and its role in signaling pathways, offering insights into its contributions to cellular processes. The characterization of CLCA1's functional properties could lead to the development of novel interventions for diseases linked to chloride channel dysfunction, thus underscoring the importance of ongoing research in this area.
