Analytical Data
-
Gene name
EIF2B1
- Application
-
Alternative Names
EIF2B1;EIF2BA;Translation initiation factor eIF2B subunit alpha
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14232
-
Expression Region
1-305aa
-
AA Sequence
MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL
-
Molecular Weight
60.7kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EIF2B1, a crucial component of the eukaryotic translation initiation machinery, encodes the eukaryotic translation initiation factor 2B (eIF2B), which plays a vital role in the regulation of protein synthesis. Mutations in the EIF2B1 gene have been linked to various neurodegenerative diseases, particularly leukodystrophies, which are characterized by white matter degeneration in the brain. The study of EIF2B1 recombinant proteins has garnered significant attention due to their potential to illuminate the underlying mechanisms of these diseases. Researchers aim to investigate how different mutations affect the functionality of eIF2B, thereby impacting cellular stress responses and protein synthesis. By producing and analyzing EIF2B1 recombinant proteins, scientists can derive insights into the structure-function relationship of this essential factor and its implications in the pathology of related disorders. Understanding these mechanisms not only contributes to the basic knowledge of cellular translation processes but also opens potential avenues for therapeutic strategies targeting eIF2B-related dysfunctions. Overall, the study of EIF2B1 and its recombinant proteins is pivotal in unraveling the complexities of translation regulation and its ramifications in health and disease.











