Analytical Data
-
Gene name
OLIG1
- Application
-
Alternative Names
OLIG1；BHLHB6；BHLHE21；Oligodendrocyte transcription factor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TAK6
-
Expression Region
17-105aa
-
AA Sequence
MLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQQQ
-
Molecular Weight
11.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OLIG1, a member of the oligodendrocyte transcription factor family, plays a critical role in the development and maintenance of oligodendrocytes, the myelinating cells in the central nervous system. Research has shown that OLIG1 is essential for proper neural development, influencing the differentiation of oligodendrocyte progenitor cells and the formation of myelin sheaths around axons. Mutations or dysregulation of OLIG1 have been implicated in various neurological disorders, including multiple sclerosis and leukodystrophies, highlighting its significance in both normal and pathological conditions. The recombinant protein of OLIG1 allows researchers to investigate its functional properties, interaction with other proteins, and downstream signaling pathways in greater detail. Studies involving OLIG1 recombinant protein are crucial for understanding its mechanisms of action and potential therapeutic targets, as well as for exploring its role in neuroprotection and repair processes following injury. Additionally, OLIG1's involvement in the reprogramming of other cell types into oligodendrocyte-like cells suggests its potential in regenerative medicine and cell therapy for demyelinating diseases. Overall, the study of OLIG1 recombinant protein provides valuable insights into oligodendrocyte biology, with significant implications for developing novel treatments for neurological disorders.
