Analytical Data
-
Gene name
KCNK2
- Application
-
Alternative Names
KCNK2；TREK；TREK1；Potassium channel subfamily K member 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95069
-
Expression Region
17.7 kDa
-
AA Sequence
MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWKTVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQIVAAINAGIIPLGNTSNQISHWD
-
Molecular Weight
1-143aa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KCNK2, also known as TREK-1, is a member of the two-pore domain potassium (K2P) channel family, which plays a crucial role in maintaining the resting membrane potential and regulating neuronal excitability. Its ability to respond to various stimuli, including mechanical stretch, temperature changes, and chemical compounds, makes KCNK2 a significant focus in neuroscience and cardiovascular research. Dysfunction of KCNK2 has been linked to several pathological conditions, such as mood disorders, pain perception, and cardiac arrhythmias. Given its potential as a therapeutic target, the study of recombinant KCNK2 protein has garnered attention to better understand its functional mechanisms, physiological roles, and interactions with other cellular components. Researchers have employed various expression systems to produce recombinant KCNK2, facilitating the investigation of its biophysical properties and pharmacological profile. This approach aids in the development of novel drugs that can modulate KCNK2 activity, addressing unmet medical needs in neuropsychiatric complications and heart diseases while contributing to the broader field of ion channel research.
