Analytical Data
-
Gene name
KCND2
- Application
-
Alternative Names
KCND2；KIAA1044；Potassium voltage-gated channel subfamily D member 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NZV8
-
Expression Region
406-630aa
-
AA Sequence
VSNFSRIYHQNQRADKRRAQKKARLARIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHLLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRIPNANVSGSHQGSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL
-
Molecular Weight
27.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KCND2, a member of the potassium channel family, encodes the voltage-gated potassium channel subunit Kv4.2, which plays a crucial role in regulating neuronal excitability and action potential firing in the central nervous system. Research on KCND2 recombinant proteins has gained traction due to their involvement in various physiological and pathological processes, including neuronal communication and cardiac function. Mutations or dysregulation of KCND2 have been linked to several neurological disorders, such as epilepsy and schizophrenia, as well as cardiac arrhythmias. Understanding its structure and functioning through recombinant protein studies can provide valuable insights into the channel's biophysical properties and functional mechanisms. Additionally, these studies facilitate advancements in drug discovery aimed at modulating KCND2 activity in therapeutic applications. By utilizing techniques such as heterologous expression systems and electrophysiological recordings, researchers aim to dissect the complex regulatory mechanisms that govern KCND2 activity and to explore potential therapeutic targets for conditions arising from its dysfunction. This research not only enhances our understanding of potassium channel biology but also highlights the importance of KCND2 in health and disease, underpinning its significance as a subject of scientific investigation.
