Analytical Data
-
Gene name
EFNA5
- Application
-
Alternative Names
EFNA5;EPLG7;LERK7;Ephrin-A5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P52803
-
Expression Region
21-203aa
-
AA Sequence
QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN
-
Molecular Weight
50.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EFNA5, or Ephrin-A5, is a member of the ephrin family of proteins that play critical roles in mediating cell-cell interactions, particularly in the nervous system and during embryonic development. This protein is involved in the regulation of cell adhesion, migration, and axon guidance, significantly influencing neural patterning and tissue architecture. Research has shown that EFNA5 interacts with Eph receptors, which are tyrosine kinases that initiate signaling pathways affecting cellular responses to environmental cues. Aberrant EFNA5 signaling has been implicated in various pathological conditions, including cancer metastasis and neurological disorders. The recombinant expression of EFNA5 in laboratory settings has enabled scientists to dissect its functional roles and mechanisms at the molecular level. By studying the biochemical properties and interactions of EFNA5, researchers aim to better understand its contributions to development and disease. The production of EFNA5 as a recombinant protein also facilitates the development of potential therapeutic strategies that could target the EFNA5-Eph receptor interaction in disease contexts, offering novel insights into its role as a biomarker or therapeutic target in cancer and neurodevelopmental disorders.











