Analytical Data
-
Gene name
EFNB1
- Application
-
Alternative Names
EFNB1；EFL3；EPLG2；LERK2;Ephrin-B1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P98172
-
Expression Region
28-232aa
-
AA Sequence
LAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYK LYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFK KHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLT TSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSS GDPDG
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EFNB1, or Ephrin-B1, is a member of the ephrin family of proteins, which play crucial roles in cell signaling and communication, particularly in the context of developmental processes and neuronal guidance. It functions by binding to Eph receptors, facilitating bidirectional signaling that influences cellular behaviors such as migration, adhesion, and morphology. Research on EFNB1 has garnered significant interest due to its involvement in various physiological and pathological conditions, including neurodevelopmental disorders and cancer. Aberrant expression or mutations in EFNB1 have been linked to disruptions in normal development and the progression of tumors, making it a potential biomarker and therapeutic target. Recent advancements in recombinant protein technology have enabled the production of EFNB1 in laboratory settings, allowing for in-depth studies of its structural and functional properties. This facilitates investigations into its role in cell communication and the mechanistic understanding of its interactions with Eph receptors. The generation of EFNB1 recombinant proteins provides valuable tools for elucidating its biological functions and exploring its therapeutic potential in regenerative medicine and targeted cancer therapies. Overall, the study of EFNB1 and its recombinant counterparts contributes to a deeper understanding of cellular dynamics and offers insights that may pave the way for innovative treatment strategies in various diseases.
