Analytical Data
-
Gene name
UL99
- Application
-
Alternative Names
UL99；Cytoplasmic envelopment Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P13200
-
Expression Region
2-190aa
-
AA Sequence
GAELCKRICCEFGTTPGEPLKDALGRQVSLRSYDNIPPTSSSDEGEDDDDGEDDDNEERQQKLRLCGSGCGGNDSSSGSHREATHDGSKKNAVRSTFREDKAPKPSKQSKKKKKPSKHHHHQQSSIMQETDDLDEEDTSIYLSPPPVPPVQVVAKRLPRPDTPRTPRQKKISQRPPTPGTKKPAASLPF
-
Molecular Weight
24.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UL99, a protein encoded by the human cytomegalovirus (HCMV), plays a critical role in viral assembly and egress. As a member of the UL (unique long) gene family, UL99 is primarily involved in the formation of viral tegument, a layer crucial for the stability and infectivity of the virus. Recent studies have highlighted UL99's interactions with other viral proteins, suggesting its potential as a target for therapeutic strategies. The intricate mechanisms by which UL99 contributes to the viral lifecycle, including its role in regulating the packaging of viral components and facilitating the release of infectious particles, underscore the importance of this protein in both basic virology and the development of antiviral therapies. Additionally, given the significant public health impact of HCMV, particularly among immunocompromised individuals and newborns, understanding the function of UL99 could provide insights into viral pathogenesis and lead to novel interventions aimed at mitigating HCMV-related diseases.
