Analytical Data
-
Gene name
NTH1
- Application
-
Alternative Names
NTH1;NTH1;OCTS3;Endonuclease III-like Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P78549
-
Expression Region
1-312aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMCSPQESGMTALSARMLTRSRSLGPGAGPR GCREEPGPLRRREAAAEARKSHSPVKRPRKAQRLRVAYEGSDSEKGEGAE PLKVPVWEPQDWQQQLVNIRAMRNKKDAPVDHLGTEHCYDSSAPPKVRRY QVLLSLMLSSQTKDQVTAGAMQRLRARGLTVDSILQTDDATLGKLIYPVG FWRSKVKYIKQTSAILQQHYGGDIPASVAELVALPGVGPKMAHLAMAVAW GTVSGIAVDTHVHRIANRLRWTKKATKSPEETRAALEEWLPRELWHEING LLVGFGQQTCLPVHPRCHACLNQALCPAAQGL
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NTH1, or the human DNA repair enzyme known as endonuclease III-like protein 1, plays a crucial role in maintaining genomic stability by participating in the base excision repair pathway. This enzyme is responsible for recognizing and excising oxidatively damaged bases in DNA, thereby preventing the accumulation of mutations that can lead to cancer and other diseases. Research has highlighted the importance of NTH1 in cellular response to oxidative stress, as it helps repair lesions caused by reactive oxygen species. Mutations in the NTH1 gene have been linked to various conditions, including certain types of cancer and neurodegenerative disorders, which underscores the enzyme's significance in both normal physiology and disease states. As a result, NTH1 has become an attractive target for therapeutic interventions aimed at enhancing DNA repair mechanisms and potentially improving outcomes for patients with DNA repair deficiencies. Recent advances in recombinant protein technology have facilitated the production of NTH1 for structural and functional studies, enabling researchers to explore its enzymatic properties, interaction with DNA substrates, and potential as a biomarker for oxidative DNA damage. Understanding the molecular mechanisms governing NTH1 function and regulation could pave the way for the development of novel strategies in cancer treatment and prevention, highlighting the enzyme's critical importance in biomedicine.











