Analytical Data
-
Gene name
DSCR1
- Application
-
Alternative Names
DSCR1；C21LRP；DSCR2；PAC1;Proteasome assembly chaperone 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P53805
-
Expression Region
1-197aa
-
AA Sequence
MEEVDLQDLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTPIHLS
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DSCR1, or Down Syndrome Critical Region 1, is a protein encoded by a gene located on chromosome 21, which is notably linked to Down syndrome. This protein has garnered significant attention in research due to its potential role in neurodevelopment and its implications in various neurodegenerative diseases. Studies suggest that DSCR1 functions as an inhibitor of calcineurin, a calcium and calmodulin-dependent serine/threonine protein phosphatase, thereby influencing key signaling pathways involved in neuronal development, apoptosis, and synaptic plasticity. The overexpression of DSCR1 in individuals with Down syndrome may contribute to distinct neurological and physiological characteristics associated with the condition. Furthermore, research indicates that DSCR1 may also play a protective role in conditions such as Alzheimer's disease, where it is thought to help mitigate neuroinflammation and synaptic dysfunction. Understanding the molecular mechanisms and pathways associated with DSCR1 is crucial for unraveling its dual role in both development and neuroprotection, paving the way for potential therapeutic strategies targeting cognitive deficits and other related disorders. Continued exploration of DSCR1 not only enhances our understanding of its fundamental biological functions but also offers insights into the broader implications of chromosome 21 genes in health and disease.
