Cat: PA1000-921DB

Recombinant Human DRG1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DRG1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DRG1;NEDD3;Developmentally-regulated GTP-binding Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9Y295

  • Expression Region

    1-367aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMSSTLAKIAEIEAEMARTQKNKATAHHLGL LKARLAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFVGFPSVGKSTL LSNLAGVYSEVAAYEFTTLTTVPGVIRYKGAKIQLLDLPGIIEGAKDGKG RGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIG FKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDL IDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDD LLEKIWDYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLI KEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQIVKK

  • Molecular Weight

    43 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DRG1 (differentiation-related gene 1) is a protein that has garnered significant attention due to its crucial role in various biological processes, including cell differentiation, proliferation, and apoptosis. Initially identified as a gene associated with neuronal differentiation, DRG1 is involved in regulating specific signaling pathways that contribute to the development and functioning of the nervous system. Recent studies have highlighted its potential implications in cancer biology, as altered expression of DRG1 has been observed in several tumors, suggesting a link between DRG1 activity and tumorigenesis. The characterization of DRG1 as a potential biomarker for cancer and a target for therapeutic intervention is an area of active research. Additionally, understanding the molecular mechanisms underlying DRG1 function may provide insights into its role in other diseases and physiological processes. As a recombinant protein, DRG1 allows for detailed studies of its structure-function relationships and interactions with other cellular components. The development of DRG1-based assays could facilitate the discovery of novel treatment strategies that exploit its biological activities. Overall, the investigation into DRG1 and its recombinant forms represents a promising frontier in biomedical research, with the potential for significant implications in diagnostics and therapeutic development.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US