Analytical Data
-
Gene name
DENR
- Application
-
Alternative Names
DENR;DRP1;Density-regulated Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43583
-
Expression Region
2-198aa
-
AA Sequence
AADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK
-
Molecular Weight
38.0kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DENR (Density Regulated Protein) is a crucial protein involved in various cellular processes, particularly in relation to translation and response to stress. Research on DENR has gained traction due to its significant role in regulating gene expression through its interaction with ribosomes and mRNA. It has been shown to participate in the translation of specific mRNAs, especially those that code for proteins essential in stress response and cell survival. Understanding DENR's function becomes increasingly important in the context of various diseases, including cancer, where misregulation of protein synthesis can lead to uncontrolled cell proliferation. Furthermore, DENR has been implicated in mechanisms of tumorigenesis and the progression of certain cancers. The exploration of DENR’s structural features and its regulatory pathways holds potential for developing therapeutic strategies that target these processes. This growing body of research highlights the importance of DENR not just as a translational regulator, but also as a potential biomarker or therapeutic target in disease contexts, notably in cancer therapies aimed at restoring the normal regulation of protein synthesis. As scientists continue to uncover the intricacies of DENR’s functions and interactions, there is a burgeoning opportunity for novel insights that could lead to innovative treatment approaches.











