Cat: PA1000-852DB

Recombinant Human DDT Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DDT

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DDT;REDD2;RTP801L;DNA damage-inducible transcript 4-like Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P30046

  • Expression Region

    1-118aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMPFLELDTNLPANRVPAGLEKRLCAAAASI LGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAH FFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL

  • Molecular Weight

    15 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DDT, or Diphtheria Toxin Domain, is a significant focus in the study of recombinant proteins due to its potential applications in immunotherapy and targeted drug delivery. Originally derived from the diphtheria bacterium, this protein exhibits potent cytotoxicity, making it a valuable tool in cancer treatment. Researchers have been exploring the possibilities of modifying DDT to enhance its specificity and reduce side effects while maintaining its therapeutic efficacy. The ability to engineer DDT into a recombinant form allows for the development of fusion proteins that can selectively target and kill malignant cells, offering a promising alternative to conventional therapies. Additionally, DDT’s role in vaccine development is being investigated, aiming to use its immunogenic properties to create vaccines that elicit strong immune responses against various diseases. This research is driven by the need for more effective and safer treatment options in oncology and infectious diseases, as current therapies often come with substantial side effects and limitations. Advances in genetic engineering techniques have further propelled the study of DDT, allowing for the design of tailored therapies that can potentially improve patient outcomes. Overall, the exploration of DDT as a recombinant protein represents a cutting-edge intersection of microbiology, biotechnology, and medicine, holding significant promise for the future of disease treatment and prevention.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US