Analytical Data
-
Gene name
GLUT14
- Application
-
Alternative Names
GLUT14；GLUT14；Solute carrier family 2. facilitated glucose transporter member 14
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TDB8
-
Expression Region
1-520aa
-
AA Sequence
MEFHNGGHVSGIGGFLVSLTSRMKPHTLAVTPALIFAITVATIGSFQFGYNTGVINAPETIIKEFINKTLTDKANAPPSEVLLTNLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAATGGCLMGLCKIAESVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVIGILVAQIFGLELILGSEELWPVLLGFTILPAILQSAALPCCPESPRFLLINRKKEENATRILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQQPIYATISAGVVNTIFTLLSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKNHYNGMSFVCIGAILVFVACFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAYYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFEGQAHGADRSGKDGVMGMNSIEPAKETTTNV
-
Molecular Weight
56.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GLUT14, a member of the glucose transporter family, is encoded by the SLC2A14 gene and is predominantly expressed in human testis and various cancer tissues. Its distinct expression pattern and potential role in glucose metabolism have sparked interest in understanding its biological functions. Unlike other GLUT proteins, GLUT14 has a high affinity for glucose and exhibits unique regulatory mechanisms, suggesting its involvement in specific physiological and pathological conditions. Recent studies indicate that GLUT14 may play a crucial role in the development and progression of certain cancers through metabolic reprogramming, making it a potential therapeutic target. Additionally, its involvement in spermatogenesis and male fertility highlights its significance in reproductive biology. Given these intriguing functions, the recombinant expression and characterization of GLUT14 protein are essential for elucidating its mechanisms of action and for exploring its potential applications in cancer therapy and reproductive health research. Understanding GLUT14’s structure and function could lead to novel interventions for diseases influenced by glucose metabolism, providing a pathway for innovative treatments.
