Analytical Data
-
Gene name
GLUT1
- Application
-
Alternative Names
GLUT1;GLUT1;Solute carrier family 2. facilitated glucose transporter member 1
-
Species
Human
-
Source
E. coli
-
Tag
N-terminal Tags, His-tag
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P11166
-
Expression Region
251~329aa
-
AA Sequence
MMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEKAGVQQPVYATIGSGIVNTAFTVVSLFVVE
-
Molecular Weight
12.4kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
GLUT1 (Glucose Transporter 1) is a crucial protein responsible for the facilitative transport of glucose across plasma membranes in various cell types, playing a vital role in cellular energy metabolism. Its importance is underscored in both physiological and pathological contexts, as GLUT1 is involved in maintaining glucose homeostasis and energy supply in tissues with high-energy demands, such as the brain and erythrocytes. Dysregulation or mutations in GLUT1 can lead to several medical conditions, including GLUT1 deficiency syndrome, characterized by neurological impairments due to inadequate glucose transport into the central nervous system. Given its significant role in health and disease, the study of GLUT1 has attracted considerable attention, particularly in the realm of drug development and potential therapeutic interventions for metabolic disorders. The production of recombinant GLUT1 protein allows for detailed structural and functional analysis, facilitating a deeper understanding of its transport mechanisms and interactions with various substrates and inhibitors. Moreover, investigating GLUT1’s role in cancer metabolism has emerged as a key area of research, as many tumors exhibit altered glucose uptake to support rapid growth and proliferation. The recombinant expression of GLUT1, therefore, not only aids in elucidating its biological functions but also paves the way for the design of targeted therapies that could manipulate glucose transport in disease states, offering promising avenues for clinical applications.











