Analytical Data
-
Gene name
SCAMP3
- Application
-
Alternative Names
SCAMP3；C1orf3；PROPIN1；Secretory carrier-associated membrane Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14828
-
Expression Region
2-170aa
-
AA Sequence
AQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAPLPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAATAELLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYYL
-
Molecular Weight
45.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SCAMP3, or Secretory Carrier Membrane Protein 3, is a member of the SCAMP family, which plays a crucial role in the secretory pathway and membrane trafficking within cells. The research on SCAMP3 has gained importance due to its potential implications in various physiological processes such as exocytosis, cell signaling, and the maintenance of membrane integrity. It is predominantly expressed in neurons and has been linked to synaptic function, thus making it a key focus in neurobiology and studies related to neurodegenerative diseases. Furthermore, the role of SCAMP3 in modulating the intracellular transport of proteins and lipids highlights its significance in cell homeostasis and disease mechanisms. Investigating SCAMP3 through recombinant protein studies allows researchers to better understand its structural and functional properties. This research can lead to insights into how SCAMP3 interacts with other cellular components, offering potential therapeutic targets for conditions related to dysfunctional membrane transport. Recent advances in molecular biology techniques have facilitated the generation of SCAMP3 recombinant proteins, which serve as vital tools in elucidating its roles and interactions. Understanding SCAMP3 functions at the molecular level is essential for unraveling the complexities of cellular processes and could contribute to developing novel interventions for diseases where SCAMP3 is implicated.
