Cat: PA1000-840DB

Recombinant Human DCTN2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DCTN2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DCTN2;DCTN50;Dynactin subunit 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q13561

  • Expression Region

    1-406aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMADPKYADLPGIARNEPDVYETSDLPE DDQAEFDAFAQELEELTSTSVEHIIVNPNAAYDKFKDKRVGTKGLDFSDR IGKTKRTGYESGEYEMLGEGLGVKETPQQKYQRLLHEVQELTTEVEKIKT TVKESATEEKLTPVLLAKQLAALKQQLVASHLEKLLGPDAAINLTDPDGA LAKRLLLQLEATKNSKGGSGGKTTGTPPDSSLVTYELHSRPEQDKFSQAA KVAELEKRLTELETAVRCDQDAQNPLSAGLQGACLMETVELLQAKVSALD LAVLDQVEARLQSVLGKVNEIAKHKASVEDADTQSKVHQLYETIQRWSPI ASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIANSLKDNTTLLT QVQTTMRENLATVEGNFASIDERMKKLGK

  • Molecular Weight

    47 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DCTN2, or Dynactin subunit 2, is a critical component of the dynactin complex, which plays a pivotal role in intracellular transport and mitosis by linking dynein motor proteins to their cargoes. Research on DCTN2 has gained attention due to its involvement in several cellular processes, including the regulation of cell division and the transport of organelles, vesicles, and protein complexes within neurons. Mutations or dysregulation of DCTN2 have been associated with various neurodegenerative disorders, such as amyotrophic lateral sclerosis (ALS) and frontotemporal dementia (FTD), underscoring its significance in maintaining neuronal integrity and function. The study of DCTN2 recombinant proteins allows for the exploration of its structural and functional properties, providing insights into its role in cellular mechanics and potential therapeutic avenues. By generating DCTN2 in a recombinant system, researchers can analyze its interactions with other cellular components and elucidate the molecular mechanisms underlying its involvement in disease pathology. This research is crucial, as it not only contributes to our understanding of neuronal transport processes but also aids in the development of targeted treatments to combat related neurodegenerative conditions. Thus, DCTN2 recombinant protein studies are an essential focus area in the realm of cellular and molecular biology, with significant implications for human health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US