Analytical Data
-
Gene name
SLC20A3
- Application
-
Alternative Names
SLC20A3；SLC20A3；Tricarboxylate transport Protein. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P53007
-
Expression Region
47-87aa
-
AA Sequence
EYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGL
-
Molecular Weight
31.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC20A3, a member of the solute carrier family 20, encodes a sodium-dependent phosphate transporter primarily implicated in phosphate homeostasis. Its role extends beyond mere transport as emerging studies suggest SLC20A3 is involved in various cellular processes, including bone mineralization and cellular signaling. Dysregulation of SLC20A3 has been associated with several pathophysiological conditions, such as osteomalacia and various cancers, underscoring its potential as a therapeutic target. Despite its significance, the biochemical mechanisms underlying SLC20A3 function remain poorly understood, partly due to challenges in obtaining sufficient quantities of functional recombinant protein for in-depth analysis. Consequently, research focusing on the production and characterization of SLC20A3 recombinant protein has gained traction. By leveraging advanced molecular biology techniques, scientists aim to elucidate the transport mechanisms and regulatory pathways associated with SLC20A3, as well as its interactions with other cellular components. This research not only aims to clarify the physiological roles of SLC20A3 but also holds promise for discovering novel therapeutic strategies for related diseases. Understanding the structure and function of SLC20A3 will ultimately contribute to a better comprehension of phosphate metabolism and its implications in human health.
