Cat: PA2000-3603

Recombinant Human SLC20A3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SLC20A3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SLC20A3;SLC20A3;Tricarboxylate transport Protein. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P53007

  • Expression Region

    47-87aa

  • AA Sequence

    EYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGL

  • Molecular Weight

    31.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SLC20A3, a member of the solute carrier family 20, encodes a sodium-dependent phosphate transporter primarily implicated in phosphate homeostasis. Its role extends beyond mere transport as emerging studies suggest SLC20A3 is involved in various cellular processes, including bone mineralization and cellular signaling. Dysregulation of SLC20A3 has been associated with several pathophysiological conditions, such as osteomalacia and various cancers, underscoring its potential as a therapeutic target. Despite its significance, the biochemical mechanisms underlying SLC20A3 function remain poorly understood, partly due to challenges in obtaining sufficient quantities of functional recombinant protein for in-depth analysis. Consequently, research focusing on the production and characterization of SLC20A3 recombinant protein has gained traction. By leveraging advanced molecular biology techniques, scientists aim to elucidate the transport mechanisms and regulatory pathways associated with SLC20A3, as well as its interactions with other cellular components. This research not only aims to clarify the physiological roles of SLC20A3 but also holds promise for discovering novel therapeutic strategies for related diseases. Understanding the structure and function of SLC20A3 will ultimately contribute to a better comprehension of phosphate metabolism and its implications in human health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US