Analytical Data
-
Gene name
P2RY1
- Application
-
Alternative Names
P2RY1;P2Y purinoceptor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P47900
-
Expression Region
326-373aa
-
AA Sequence
LAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL
-
Molecular Weight
12.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
P2RY1, also known as the purinergic receptor P2Y1, is a G protein-coupled receptor that primarily responds to adenosine diphosphate (ADP) and plays a crucial role in various physiological processes, including platelet aggregation, vascular function, and neurotransmission. The significance of P2RY1 in cardiovascular and neurological systems has made it a target of interest for therapeutic interventions. Given its involvement in critical biological processes, understanding the structure and function of P2RY1 through recombinant protein studies is essential. Recombinant P2RY1 proteins allow researchers to investigate receptor pharmacology, signaling pathways, and interactions with ligands in a controlled environment, facilitating drug discovery and development. Moreover, studying P2RY1 can provide insights into its role in disease conditions such as thrombosis, stroke, and neurodegenerative disorders. Recent advancements in protein expression systems and purification techniques have enabled the efficient production of high-quality P2RY1 proteins, paving the way for detailed biochemical and biophysical characterization. This research not only enhances our understanding of P2RY1's functional dynamics but also aids in the design of targeted therapies that modulate its activity for clinical applications. Overall, the exploration of recombinant P2RY1 protein serves as a vital stepping stone in elucidating its biological significance and therapeutic potential.











