Analytical Data
-
Gene name
P2RX7
- Application
-
Alternative Names
P2RX7；P2X purinoceptor 7
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99572
-
Expression Region
47-334aa
-
AA Sequence
SDKLYQRKEPVISSVHTKVKGIAEVKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCPEYPTRRTLCSSDRGCKKGWMDPQSKGIQTGRCVVHEGNQKTCEVSAWCPIEAVEEAPRPALLNSAENFTVLIKNNIDFPGHNYTTRNILPGLNITCTFHKTQNPQCPIFRLGDIFRETGDNFSDVAIQGGIMGIEIYWDCNLDRWFHHCHPKYSFRRLDDKTTNVSLYPGYNFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLV
-
Molecular Weight
43.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
P2RX7, a member of the purinergic receptor family, encodes a protein that functions as a ligand-gated ion channel, primarily activated by ATP. This receptor plays a critical role in various physiological processes, including extracellular ATP signaling, the modulation of inflammation, and the regulation of immune responses. Research has highlighted P2RX7's significance in the pathogenesis of several diseases, including neurodegenerative disorders, chronic pain, and autoimmune diseases. Abnormal activation of P2RX7 can lead to excessive inflammatory responses and cell death, indicating its potential as a therapeutic target. The development of P2RX7 recombinant proteins allows for in-depth studies into its structure-function relationships, signaling pathways, and interaction with other cellular components. These studies are vital for understanding how P2RX7 contributes to disease mechanisms and for exploring novel treatment strategies that could modulate its activity. Through recombinant protein technology, researchers can generate purified and functional P2RX7 for biochemical assays, pharmacological studies, and potential therapeutic applications, making it a focal point of ongoing biomedical research.
