Analytical Data
-
Gene name
PTDSS1
- Application
-
Alternative Names
PTDSS1；KIAA0024；PSSA；Phosphatidylserine synthase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P48651
-
Expression Region
1-35aa
-
AA Sequence
MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITID
-
Molecular Weight
31.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PTDSS1, or Phosphatidylserine Synthase 1, is an essential enzyme involved in the biosynthesis of phosphatidylserine (PS), a critical phospholipid for cellular function. PS plays a vital role in various biological processes, including apoptosis, cell signaling, and membrane dynamics. Dysregulation of PS metabolism has been linked to several diseases, including neurodegenerative disorders and cancer. Research on PTDSS1 has gained momentum due to its potential as a therapeutic target, as enhancing PS synthesis could promote neuroprotection and support cancer treatment strategies. The recombinant form of PTDSS1 is utilized in various studies to elucidate its structural and functional properties, enabling researchers to understand its catalytic mechanisms and regulatory pathways. The generation of PTDSS1 recombinant protein allows for detailed investigation into its interaction with other cellular components and its role in lipid metabolism. Furthermore, understanding PTDSS1's functional implications not only contributes to basic biological knowledge but also opens avenues for novel therapeutic interventions aimed at modulating PS levels in pathological conditions. Therefore, the study of PTDSS1 recombinant protein represents a significant aspect of biochemistry and cell biology, with promising implications for the development of new therapeutic strategies in disease contexts where phospholipid metabolism is disrupted.
