Cat: PA2000-3598

Recombinant Human PTDSS1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PTDSS1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PTDSS1;KIAA0024;PSSA;Phosphatidylserine synthase 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P48651

  • Expression Region

    1-35aa

  • AA Sequence

    MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITID

  • Molecular Weight

    31.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PTDSS1, or Phosphatidylserine Synthase 1, is an essential enzyme involved in the biosynthesis of phosphatidylserine (PS), a critical phospholipid for cellular function. PS plays a vital role in various biological processes, including apoptosis, cell signaling, and membrane dynamics. Dysregulation of PS metabolism has been linked to several diseases, including neurodegenerative disorders and cancer. Research on PTDSS1 has gained momentum due to its potential as a therapeutic target, as enhancing PS synthesis could promote neuroprotection and support cancer treatment strategies. The recombinant form of PTDSS1 is utilized in various studies to elucidate its structural and functional properties, enabling researchers to understand its catalytic mechanisms and regulatory pathways. The generation of PTDSS1 recombinant protein allows for detailed investigation into its interaction with other cellular components and its role in lipid metabolism. Furthermore, understanding PTDSS1's functional implications not only contributes to basic biological knowledge but also opens avenues for novel therapeutic interventions aimed at modulating PS levels in pathological conditions. Therefore, the study of PTDSS1 recombinant protein represents a significant aspect of biochemistry and cell biology, with promising implications for the development of new therapeutic strategies in disease contexts where phospholipid metabolism is disrupted.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US