Cat: PA1000-829DB

Recombinant Human DARS Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DARS

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DARS;DARS;Aspartate--tRNA ligase. cytoplasmic

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P14868

  • Expression Region

    1-501aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMPSASASRKSQEKPREIMDAAEDYAKERYG ISSMIQSQEKPDRVLVRVRDLTIQKADEVVWVRARVHTSRAKGKQCFLVL RQQQFNVQALVAVGDHASKQMVKFAANINKESIVDVEGVVRKVNQKIGSC TQQDVELHVQKIYVISLAEPRLPLQLDDAVRPEAEGEEEGRATVNQDTRL DNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEG GANVFTVSYFKNNAYLAQSPQLYKQMCICADFEKVFSIGPVFRAEDSNTH RHLTEFVGLDIEMAFNYHYHEVMEEIADTMVQIFKGLQERFQTEIQTVNK QFPCEPFKFLEPTLRLEYCEALAMLREAGVEMGDEDDLSTPNEKLLGHLV KEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFMRGEEILSGAQ RIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLF LGLHNVRQTSMFPRDPKRLTP

  • Molecular Weight

    59 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DARS, or aspartyl-tRNA synthetase, is a critical enzyme responsible for the charging of tRNA molecules with aspartic acid, an essential amino acid in protein synthesis. Research into DARS has gained significant attention due to its vital role in generating the correct translation of genetic information into proteins. Mutations and dysfunctions in DARS have been linked to a variety of genetic disorders, including certain forms of neurodegenerative diseases and developmental abnormalities. Understanding the structural and functional dynamics of DARS is crucial for unraveling its involvement in these pathologies. Moreover, investigating DARS provides insights into the broader mechanisms of aminoacyl-tRNA synthetases, which are pivotal for cellular protein synthesis and overall metabolic function. The study of DARS also holds potential therapeutic implications, as targeting this enzyme may offer new avenues for treating associated diseases. Recent advances in techniques such as X-ray crystallography and NMR spectroscopy have facilitated a deeper understanding of the DARS structure and its interaction with tRNA substrates. These insights are instrumental in deciphering how mutations affect enzyme activity and lead to disease states. Thus, ongoing research into DARS not only enhances our understanding of fundamental biochemical processes but also contributes to the development of innovative therapeutic strategies for various ailments linked to protein synthesis errors.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US