Analytical Data
-
Gene name
UQCR11
- Application
-
Alternative Names
UQCR11；UQCR；Cytochrome b-c1 complex subunit 10
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14957
-
Expression Region
1-56aa
-
AA Sequence
MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN
-
Molecular Weight
33.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UQCR11, also known as ubiquinone-cytochrome c reductase assembly factor, plays a crucial role in the assembly and function of the mitochondrial respiratory chain complex III. Research on UQCR11 has garnered interest due to its potential implications in mitochondrial disorders and other metabolic diseases. Mitochondria are essential for energy production in cells, and any dysfunction in the respiratory chain can lead to severe cellular consequences, including reduced ATP synthesis and increased oxidative stress. Studies indicate that mutations or deficiencies in UQCR11 can disrupt the assembly of the respiratory chain complexes, leading to compromised mitochondrial function and various pathological conditions. Additionally, UQCR11 has been implicated in certain types of cancer, where altered mitochondrial activity can contribute to the malignancy's development and progression. The characterization of UQCR11’s structure and function not only enhances the understanding of mitochondrial biology but also offers potential therapeutic avenues for conditions related to mitochondria, underlining the importance of this protein in both basic and clinical research.
