Cat: PA1000-826DB

Recombinant Human DAO Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DAO

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DAO;DAMOX;D-amino-acid oxidase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P14920

  • Expression Region

    1-347aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMRVVVIGAGVIGLSTALCIHERYHSVLQPL DIKVYADRFTPLTTTDVAAGLWQPYLSDPNNPQEADWSQQTFDYLLSHVH SPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPRELDMFPDYGY GWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVN CTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYNSPYII PGTQTVTLGGIFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERT GFRPVRPQIRLEREQLRTGPSNTEVIHNYGHGGYGLTIHWGCALEAAKLF GRILEEKKLSRMPPSHL

  • Molecular Weight

    42 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Dao (D-amino acid oxidase) is an enzyme that plays a crucial role in the metabolism of D-amino acids, which are not commonly found in proteins but can influence various physiological processes. In recent years, research has increasingly focused on the role of D-amino acids in neurological functions, cellular signaling, and even the development of specific diseases. The study of DAO has gained significant momentum due to its potential implications in conditions such as schizophrenia, where altered levels of D-serine, a substrate of DAO, have been implicated. Additionally, the enzyme is of interest in the context of cellular stress responses and metabolic disorders. Recent advances in protein engineering have enabled the development of recombinant DAO proteins with enhanced stability, activity, and specificity, opening new avenues for therapeutic applications and biochemical studies. These restructured proteins can be utilized to better understand the enzyme's mechanism, its interaction with substrates, and its regulatory pathways. As research continues, unraveling the functional roles and potential therapeutic benefits of DAO and its products is becoming increasingly important in the fields of biochemistry, pharmacology, and neuroscience, highlighting the need for innovative techniques to study and manipulate this enzyme systematically.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US