Analytical Data
-
Gene name
DAP
- Application
-
Alternative Names
DAP;DAP1;Death-associated Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P51397
-
Expression Region
2-102aa
-
AA Sequence
SSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK
-
Molecular Weight
38.0kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DAP (Diverse Adhesion Proteins) are a class of proteins implicated in various biological processes, including cellular adhesion, immune response, and development. Research on DAP recombinant proteins has gained significant attention due to their potential applications in biotechnology and medicine. These proteins play crucial roles in facilitating cell-cell and cell-matrix interactions, making them essential in tissue engineering and regenerative medicine. Furthermore, DAPs have been studied for their involvement in disease mechanisms, especially in cancer metastasis and autoimmune disorders. The ability to produce DAPs through recombinant DNA technology allows for the generation of large quantities of these proteins, enabling detailed structural and functional studies. Additionally, recombinant DAPs can be engineered for enhanced specificity or activity, providing valuable tools for therapeutic interventions. As the understanding of their mechanisms continues to evolve, DAP recombinant proteins are being explored for their roles as biomarkers, drug targets, and therapeutic agents, highlighting their significance in advancing health and disease research. Overall, the study of DAP recombinant proteins stands at the intersection of molecular biology and clinical application, promising innovations in both diagnostics and therapeutics.











