Cat: PA1000-9474

Recombinant Human PAX6 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PAX6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PAX6;AN2;Paired box Protein Pax-6

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P26367

  • Expression Region

    2-422aa

  • AA Sequence

    29aa_Tag_QNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDI SRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKR ECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQMGADGM YDKLRMLNGQTGSWGTRPGWYPGTSVPGQPTQDGCQQQEGGGENTNSISS NGEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARER LAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRRQASNTPSHIPISSSFS TSVYQPIPQPTTPVSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLP MQPPVPSQTSSYSCMLPTSPSVNGRSYDTYTPPHMQTHMNSQPMGTSGTT STGLISPGVSVPVQVPGSEPDMSQYWPRLQLEESGGGGSPGRRRRRRRRR RR

  • Molecular Weight

    49 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PAX6 is a pivotal transcription factor that plays a crucial role in eye development, neurogenesis, and organogenesis. Mutations in the PAX6 gene are associated with a variety of congenital eye disorders, such as aniridia and Peters anomaly, highlighting its importance in ocular biology. The study of PAX6 recombinant proteins focuses on understanding the molecular mechanisms underlying its function and regulation. By producing and analyzing PAX6 recombinant proteins, researchers can investigate the interactions of PAX6 with other cellular factors, its role in gene expression regulation, and its regulatory pathways during developmental processes. Furthermore, these studies can help elucidate the effects of specific mutations and could pave the way for potential therapeutic interventions in PAX6-related diseases. The development of PAX6 recombinant proteins also facilitates the exploration of its potential in regenerative medicine and tissue engineering, as understanding its signaling pathways may unlock new strategies for repairing or regenerating affected ocular tissues. Overall, the recombinant protein approach provides valuable insights into the functional complexities of PAX6, advancing our knowledge of developmental biology and its clinical implications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US