Analytical Data
-
Gene name
CXCL11
- Application
-
Alternative Names
CXCL11；ITAC；SCYB11；SCYB9B;C-X-C motif chemokine 11
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14625
-
Expression Region
22-94aa
-
AA Sequence
FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKG QRCLNPKSKQARLIIKKVERKNF
-
Molecular Weight
8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CXCL11, also known as interferon-inducible T cell alpha chemoattractant (I-TAC), is a chemokine that plays a crucial role in the immune response by attracting T cells and natural killer (NK) cells to sites of inflammation or infection. Its importance is underscored in various pathological conditions, including viral infections, autoimmune diseases, and cancer. The recombinant protein form of CXCL11 has garnered increasing attention in research due to its potential therapeutic applications, particularly in enhancing immune response and modulating inflammatory processes. Studies have shown that CXCL11 can facilitate the migration of immune cells, which is vital for effective antitumor immunity and the coordination of immune responses. Furthermore, CXCL11's unique ability to bind to and activate its receptors, CXCR3-A and CXCR3-B, makes it a target for therapeutic interventions aimed at reprogramming the immune system. Given its dual role in both promoting and inhibiting immune responses, understanding the mechanisms of CXCL11 function and its spatial regulation in the immune landscape may provide critical insights into developing novel treatments for cancers and debilitating chronic inflammatory conditions. Consequently, investigating recombinant forms of CXCL11 could lead to advances in immunotherapy, providing new avenues for manipulating immune responses in a controlled manner.
