Cat: PA1000-793DB

Recombinant Human CXCL11 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CXCL11

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CXCL11;ITAC;SCYB11;SCYB9B;C-X-C motif chemokine 11

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O14625

  • Expression Region

    22-94aa

  • AA Sequence

    FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKG QRCLNPKSKQARLIIKKVERKNF

  • Molecular Weight

    8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CXCL11, also known as interferon-inducible T cell alpha chemoattractant (I-TAC), is a chemokine that plays a crucial role in the immune response by attracting T cells and natural killer (NK) cells to sites of inflammation or infection. Its importance is underscored in various pathological conditions, including viral infections, autoimmune diseases, and cancer. The recombinant protein form of CXCL11 has garnered increasing attention in research due to its potential therapeutic applications, particularly in enhancing immune response and modulating inflammatory processes. Studies have shown that CXCL11 can facilitate the migration of immune cells, which is vital for effective antitumor immunity and the coordination of immune responses. Furthermore, CXCL11's unique ability to bind to and activate its receptors, CXCR3-A and CXCR3-B, makes it a target for therapeutic interventions aimed at reprogramming the immune system. Given its dual role in both promoting and inhibiting immune responses, understanding the mechanisms of CXCL11 function and its spatial regulation in the immune landscape may provide critical insights into developing novel treatments for cancers and debilitating chronic inflammatory conditions. Consequently, investigating recombinant forms of CXCL11 could lead to advances in immunotherapy, providing new avenues for manipulating immune responses in a controlled manner.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US