Analytical Data
-
Gene name
NT
- Application
-
Alternative Names
NT；NTF5；Neurotrophin-4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P34130
-
Expression Region
81-210aa
-
AA Sequence
M+GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAG GSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVR ALTADAQGRVGWRWIRIDTACVCTLLSRTGRA
-
Molecular Weight
28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of NT (neurotrophin) recombinant proteins has garnered significant attention in the field of neuroscience and biomedicine due to their crucial roles in neuronal development, survival, and function. Neurotrophins, such as brain-derived neurotrophic factor (BDNF) and nerve growth factor (NGF), are a family of secreted proteins that maintain the health and function of neurons by promoting cell survival, differentiation, and synaptic plasticity. Given their essential functions in the central and peripheral nervous systems, alterations in neurotrophin signaling have been implicated in various neurological disorders, including Alzheimer's disease, depression, and neuropathic pain. The advent of recombinant DNA technology has facilitated the production of NT proteins in heterologous systems, allowing for the generation of large quantities of these proteins with high purity and biological activity. Research utilizing NT recombinant proteins has enabled scientists to unravel complex mechanisms of neurotrophin signaling pathways and their impact on neuronal health and disease. Moreover, these proteins have potential therapeutic applications, as they can be used for drug development, regenerative medicine, and enhancing nerve repair. By studying NT recombinant proteins, researchers aim to identify novel strategies to harness their beneficial effects on the nervous system, ultimately contributing to the development of innovative treatments for various neurological conditions.
