Cat: PA1000-9446

Recombinant Human NT Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NT

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NT;NTF5;Neurotrophin-4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P34130

  • Expression Region

    81-210aa

  • AA Sequence

    M+GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAG GSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVR ALTADAQGRVGWRWIRIDTACVCTLLSRTGRA

  • Molecular Weight

    28 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of NT (neurotrophin) recombinant proteins has garnered significant attention in the field of neuroscience and biomedicine due to their crucial roles in neuronal development, survival, and function. Neurotrophins, such as brain-derived neurotrophic factor (BDNF) and nerve growth factor (NGF), are a family of secreted proteins that maintain the health and function of neurons by promoting cell survival, differentiation, and synaptic plasticity. Given their essential functions in the central and peripheral nervous systems, alterations in neurotrophin signaling have been implicated in various neurological disorders, including Alzheimer's disease, depression, and neuropathic pain. The advent of recombinant DNA technology has facilitated the production of NT proteins in heterologous systems, allowing for the generation of large quantities of these proteins with high purity and biological activity. Research utilizing NT recombinant proteins has enabled scientists to unravel complex mechanisms of neurotrophin signaling pathways and their impact on neuronal health and disease. Moreover, these proteins have potential therapeutic applications, as they can be used for drug development, regenerative medicine, and enhancing nerve repair. By studying NT recombinant proteins, researchers aim to identify novel strategies to harness their beneficial effects on the nervous system, ultimately contributing to the development of innovative treatments for various neurological conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US