Analytical Data
-
Gene name
CTSD
- Application
-
Alternative Names
CTSD；CPSD;Cathepsin D
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P07339
-
Expression Region
67-403aa
-
AA Sequence
IPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNR
-
Molecular Weight
63.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CTSD, or Cathepsin D, is a lysosomal aspartyl protease that plays a crucial role in various physiological processes, including protein degradation, autophagy, and antigen presentation. Its dysregulation has been implicated in several diseases, including cancer, neurodegenerative disorders, and autoimmune diseases, making it a significant target for therapeutic research. The study of CTSD has gained momentum due to its association with tumor progression and metastasis, where it may enhance cancer cell invasion and promote immune evasion. In particular, researchers have focused on the characterization of recombinant CTSD protein to understand its structure-function relationships better and its substrate specificity. The recombinant protein production allows for the generation of large quantities of CTSD for in vitro and in vivo studies, facilitating the exploration of its enzymatic mechanisms and potential inhibitors. Advances in molecular biology techniques, including genetic engineering and protein purification methods, have made it possible to produce high-quality recombinant CTSD. The insights gained from these studies not only advance our understanding of CTSD's biological roles but also pave the way for the development of novel therapeutic strategies aimed at modulating its activity in disease contexts. Overall, CTSD research holds promise in identifying new biomarkers and pharmaceutical targets, contributing to more effective treatments for various health conditions.
