Analytical Data
-
Gene name
FAM167A
- Application
-
Alternative Names
FAM167A；C8orf13；Protein FAM167A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96KS9
-
Expression Region
1-214aa
-
AA Sequence
MSVPQIHVEEVGAEEGAGAAAPPDDHLRSLKALTEKLRLETRRPSYLEWQARLEEHTWPFPRPAAEPQASLEEGERGGQEPLLPLREAGQHPPSARSASQGARPLSTGKLEGFQSIDEAIAWLRKELTEMRLQDQQLARQLMRLRGDINKLKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTPLKLIGVTKMNINSRRFSLC
-
Molecular Weight
28.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM167A, also known as the Family with Sequence Similarity 167 Member A, is a gene that encodes a protein implicated in various biological processes, including immune response and cell signaling. Research into FAM167A is gaining momentum due to its potential role in autoimmune diseases and infectious diseases. Its expression patterns and interactions with other proteins suggest that it may act as a regulatory molecule in immune responses. Furthermore, studies have shown that variations in the FAM167A gene may be associated with susceptibility to certain diseases, prompting scientists to explore its functional mechanisms and therapeutic implications. Recombinant protein studies of FAM167A allow researchers to investigate its structural properties and biological functions in vitro, providing insights into how it may influence immune system behavior. These investigations also pave the way for potential applications in drug development and biomarkers for disease diagnosis. Understanding FAM167A at the molecular level is crucial for elucidating its role in health and disease, ultimately contributing to the broader field of immunology and therapeutic innovation.
