Analytical Data
-
Gene name
KIR2DL5
- Application
-
Alternative Names
KIR2DL5；CD158F；CD158F1；KIR2DL5；Killer cell immunoglobulin-like receptor 2DL5A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NHK3
-
Expression Region
1-375aa
-
AA Sequence
MSLMVVSMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVDGTFQADFPLGPATHGGTYTCFSSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLHILIGTSVAIILFIILFFFLLHCCCSNKKNAAVMDQEPAGDRTVNREDSDDQDPQEVTYAQLDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQALRGSSRETTALSQNRVASSHVPAAGI
-
Molecular Weight
40.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KIR2DL5 is a member of the killer immunoglobulin-like receptor (KIR) family, which plays a crucial role in the regulation of the immune response, particularly in the recognition of self and non-self cells by natural killer (NK) cells. As a receptor found on the surface of NK cells, KIR2DL5 is known to interact with specific molecules on target cells, influencing immune surveillance and responses to infections and tumor cells. This receptor is unique due to its capability to recognize diverse HLA class I molecules, which are pivotal for distinguishing healthy cells from those that are infected or transformed. The study of recombinant KIR2DL5 protein has gained significance in immunology and therapeutic research, as understanding its structure and function can provide insights into its role in immune regulation. Additionally, KIR2DL5 has been implicated in various diseases, including autoimmune disorders and cancers, making it a potential target for novel immunotherapeutic strategies. Researchers focus on producing recombinant KIR2DL5 to explore its binding affinities, signal transduction pathways, and potential therapeutic applications, ultimately aiming to harness its properties for enhancing immune responses against malignancies and infectious diseases. The recombinant form of the protein is also pivotal for the development of diagnostic tools and vaccine strategies, underscoring the importance of KIR2DL5 in modern immunological research.
