Analytical Data
-
Gene name
KIR2DS2
- Application
-
Alternative Names
KIR2DS2；CD158J；NKAT5；Killer cell immunoglobulin-like receptor 2DS2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P43631
-
Expression Region
1-304aa
-
AA Sequence
MSLMVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFEHFLLHREGKYKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHVLIGTSVVKIPFTILLFFLLHRWCSNKKNAAVMDQEPAGNRTVNSEDSDEQDHQEVSYA
-
Molecular Weight
33.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KIR2DS2 is a member of the Killer Immunoglobulin-like Receptor (KIR) family, which plays a crucial role in the regulation of natural killer (NK) cell activity. It is primarily expressed on NK cells and is known for its ability to recognize specific ligands on target cells, contributing to immune surveillance and response against tumor cells and viral infections. The study of KIR2DS2 is significant due to its potential implications in cancer immunotherapy and transplantation. Research has shown that KIR2DS2 can influence the outcome of various diseases, particularly in the context of their interactions with human leukocyte antigen (HLA) class I molecules. Understanding the structure and function of KIR2DS2, including its ligands and signaling pathways, is essential for developing therapeutic strategies that harness the power of NK cells. Furthermore, the generation of recombinant KIR2DS2 proteins facilitates detailed analysis of its biological activity and receptor-ligand interactions, aiding in the optimization of NK cell-based therapies. Overall, the research surrounding KIR2DS2 is pivotal in enhancing our understanding of immune modulation and developing novel approaches to treat malignancies and improve patient outcomes in allogeneic stem cell transplantation contexts.
