Analytical Data
-
Gene name
CTNNBIP1
- Application
-
Alternative Names
CTNNBIP1；ICAT;Beta-catenin-interacting Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NSA3
-
Expression Region
1-81aa
-
AA Sequence
MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ
-
Molecular Weight
36.2kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CTNNBIP1, also known as catenin beta-interacting protein 1, plays a crucial role in cellular signaling pathways, particularly those involving the Wnt/β-catenin pathway, which is vital for embryonic development, cell proliferation, and differentiation. Abnormal regulation of this pathway has been linked to various cancers and developmental disorders. The protein interacts with β-catenin, modulating its activity and stability, thereby influencing gene expression associated with cell adhesion and migration. Studies have shown that CTNNBIP1 may act as a tumor suppressor in several contexts, making it a focal point for research in cancer biology. Recombinant protein technology enables the production of CTNNBIP1 in vitro, facilitating detailed biochemical studies and offering insights into its functional mechanisms and potential as a therapeutic target. Understanding the structure and function of CTNNBIP1 at the molecular level could lead to innovative strategies for cancer treatment and elucidate its role in other pathophysiological conditions, thereby underscoring its significance in both basic and applied biomedical research.
