Analytical Data
-
Gene name
VSIG1
- Application
-
Alternative Names
VSIG1；GPA34；V-set and immunoglobulin domain-containing Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86XK7
-
Expression Region
22-232aa
-
AA Sequence
VQVTIPDGFVNVTVGSNVTLICIYTTTVASREQLSIQWSFFHKKEMEPISIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNNPPDFLGQNQGILNVSVLVKPSKPLCSVQGRPETGHTISLSCLSALGTPSPVYYWHKLEGRDIVPVKENFNPTTGILVIGNLTNFEQGYYQCTAINRLGNSSCEIDLTSSHPE
-
Molecular Weight
26.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VSIG1 (V-set and immunoglobulin domain-containing protein 1) is a member of the immunoglobulin superfamily and has emerged as a crucial player in immune regulation. It is primarily expressed in various immune cells, including T cells and dendritic cells, where it functions as a receptor that modulates immune responses. The study of VSIG1 is particularly relevant in the context of autoimmune diseases, cancer, and transplantation, where its role in inhibiting T cell activation has garnered attention. Researchers have focused on its potential as a therapeutic target to enhance immune tolerance and mitigate excessive immune responses. Recent advancements in recombinant protein technology have enabled the production and characterization of VSIG1, facilitating in-depth studies of its structure-function relationships and interactions with other immune modulators. By elucidating the signaling pathways and mechanisms through which VSIG1 exerts its effects, scientists aim to develop novel immunotherapeutic strategies that harness its regulatory capabilities. Overall, the investigation of VSIG1 recombinant protein offers promising insights into the complex regulation of immune responses and its implications in health and disease.
