Analytical Data
-
Gene name
KIR2DL2
- Application
-
Alternative Names
KIR2DL2;HLAC;HLA class I histocompatibility antigen. C alpha chain
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P43627
-
Expression Region
22-348aa
-
AA Sequence
HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVIGNPSNSWPSPTEPSSKTGNPRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYAELPNAESRSKVVSCP
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KIR2DL2, a member of the Killer Immunoglobulin-like Receptors (KIR) family, plays a crucial role in the regulation of natural killer (NK) cell functions and the immune response. This receptor is primarily expressed on NK cells and interacts with specific ligands, such as HLA-C molecules, to either activate or inhibit cytotoxic activity against target cells. Research on KIR2DL2 has gained significance due to its implications in various pathological conditions, including viral infections, cancer, and autoimmune diseases. Variations in KIR genes, including KIR2DL2, have been associated with differential susceptibility to these diseases and can influence the outcome of immunotherapy. The study of KIR2DL2 recombinant proteins is essential for understanding its structure-function relationship, signaling pathways, and potential therapeutic applications. By producing and characterizing recombinant KIR2DL2, researchers aim to elucidate its role in immune regulation and explore its utility in developing novel immunotherapeutic strategies. This research not only contributes to the basic understanding of immune mechanisms but also holds promise for enhancing adoptive cell therapies and improving patient outcomes in cancer treatment.











