Analytical Data
-
Gene name
SLC7A11
- Application
-
Alternative Names
SLC7A11；Cystine/glutamate transporter
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UPY5
-
Expression Region
1-501aa
-
AA Sequence
MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL
-
Molecular Weight
58.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC7A11, also known as System X- or cysteine/glutamate antiporter, has garnered significant attention in recent years due to its critical role in cellular amino acid transport and redox homeostasis. This protein, encoded by the SLC7A11 gene, is primarily involved in the transport of cysteine, which is vital for the synthesis of glutathione, a major antioxidant in the body. Dysregulation of SLC7A11 has been implicated in various pathological conditions, including cancer, neurodegenerative diseases, and metabolic disorders. In cancer, for instance, elevated SLC7A11 expression is associated with increased cellular survival through enhanced cysteine availability, aiding in the detoxification of reactive oxygen species and promoting tumor growth. Researchers are now focusing on the structural and functional characterization of SLC7A11 to better understand its transport mechanisms and regulatory pathways. The production of recombinant SLC7A11 protein in heterologous expression systems is crucial for these studies as it allows for detailed biochemical analyses and the exploration of potential therapeutic targets. Understanding how SLC7A11 operates at the molecular level could lead to innovative strategies for manipulating its function, potentially offering new avenues for treating diseases where SLC7A11 activity is disrupted. This research is not only vital for advancing our knowledge of cellular transport mechanisms but also for developing targeted therapies aimed at modulating SLC7A11 activity in various diseases.
