Analytical Data
-
Gene name
OARD1
- Application
-
Alternative Names
OARD1；C6orf130；TARG1；ADP-ribose glycohydrolase OARD1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y530
-
Expression Region
2-152aa
-
AA Sequence
ASSLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAVLKRDGRYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEVFEATDIKITVYTL
-
Molecular Weight
24.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The OARD1 protein, or the octopamine receptor D1, plays a crucial role in the modulation of neurotransmission and cellular signaling pathways in various biological systems. Initially identified in insect models, OARD1 has garnered significant attention due to its potential implications in neurobiology, particularly in understanding how hormonal signals influence behavior and physiological processes. Research into OARD1 has expanded beyond invertebrates, with studies exploring its homologs in vertebrates and their role in stress response, cognitive functions, and metabolic regulation. The recombinant expression of OARD1 has facilitated detailed investigations into its structure-function relationships, receptor activation mechanisms, and potential interactions with ligands. Given the growing interest in developing targeted therapies for neurological disorders and metabolic diseases, the functional characterization of OARD1 and the development of OARD1-based interventions are considered promising avenues for future research. Understanding OARD1’s role could provide insights into novel therapeutic strategies, enhancing our ability to manipulate octopaminergic signaling pathways for clinical applications. Consequently, the study of OARD1 recombinant proteins not only contributes to fundamental biological knowledge but also holds the potential for translational applications in medicine and pharmacology.
