Cat: PA1000-739DB

Recombinant Human CSN2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CSN2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CSN2;CSN2;TRIP15;COP9 signalosome complex subunit 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P61201

  • Expression Region

    1-443aa

  • AA Sequence

    MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAA LSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIR SAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFK TNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYAL EIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGE FEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAK PYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEEL LRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHG RIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA

  • Molecular Weight

    54 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CSN2, or the alpha subunit of the casein protein, holds significant importance in the field of agricultural biotechnology and dairy research. Caseins are key components of milk, crucial for cheese production and nutritional quality. In recent years, understanding the genetic and molecular basis of casein proteins like CSN2 has garnered attention due to their implications for dairy cattle breeding and milk quality enhancement. Researchers have focused on the genetic modification and recombinant expression of CSN2 to investigate its effects on the properties of milk, such as protein content, texture, and taste. By employing techniques like recombinant DNA technology, scientists can produce CSN2 in various host systems, allowing for detailed studies of its structure-function relationships. The reconstituted protein can also serve as a valuable tool for elucidating the role of CSN2 in milk coagulation and its interactions with other milk components. Furthermore, insights from CSN2 research may lead to the development of new dairy products with improved health benefits, catering to consumer demands for nutritional innovation. As the dairy industry faces challenges such as climate change, genetic diversity, and evolving consumer preferences, the ability to manipulate casein composition through CSN2 research presents exciting opportunities for sustainable dairy production and enhanced food security.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US