Analytical Data
-
Gene name
CROP
- Application
-
Alternative Names
CROP;CREAP1;CROP;O48;Luc7-like Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95232
-
Expression Region
1-79aa
-
AA Sequence
MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKV
-
Molecular Weight
13.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CROP (Cysteine-Rich and Oligomeric Peptides) recombinant proteins are an emerging focus in the fields of biotechnology and molecular biology due to their unique structural and functional properties. These proteins are characterized by a high content of cysteine residues, which often facilitate the formation of disulfide bonds, leading to stable and functional oligomeric structures. Their ability to adopt diverse conformations makes CROP proteins ideal candidates for various applications, such as targeted drug delivery, enzyme engineering, and biosensors. The increasing demand for biopharmaceuticals and the need for high specificity and efficacy in therapeutic agents have driven research into the design and production of CROP recombinant proteins. This area of study employs advanced techniques like genetic engineering and synthetic biology to optimize the expression and purification processes, enhancing yield and functionality. Furthermore, understanding the folding pathways and stability of these proteins can unveil their potential in therapeutic applications, including cancer therapy and vaccine development. Research efforts are also directed towards elucidating the interaction mechanisms between CROP proteins and biological targets, which is crucial for their application in drug design and development. Overall, the exploration of CROP recombinant proteins holds promise for advancing biotechnological innovations and addressing current challenges in medicine and pharmaceutical science.











