Analytical Data
-
Gene name
CD47
- Application
-
Alternative Names
CD47;MER6;Leukocyte surface antigen CD47
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q08722-3
-
Expression Region
19-139aa
-
AA Sequence
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTF DGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTE LTREGETIIELKYRVVSWFSP
-
Molecular Weight
40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD47, also known as the "don't eat me" signal, is a cell surface protein that plays a crucial role in regulating the immune response by inhibiting phagocytosis, the process by which immune cells engulf and destroy pathogens or damaged cells. Its interaction with the immune inhibitory receptor SIRPα on macrophages sends a signal that prevents these immune cells from attacking healthy tissues. Overexpression of CD47 is commonly observed in various types of cancer, allowing cancer cells to evade immune surveillance. Consequently, research focused on CD47 and its pathways has gained significant attention, particularly in the context of cancer immunotherapy. The development of CD47 recombinant proteins aims to elucidate its biological functions and identify potential therapeutic applications. These proteins can serve as tools to study CD47 interactions, influence cell signaling, and develop strategies to block this pathway, potentially enabling enhanced phagocytosis of cancer cells. Understanding the mechanisms underlying CD47's role in immune evasion can lead to innovative treatments that enhance the body’s ability to fight cancer by removing the protective signals that allow tumors to escape immune detection.











