Analytical Data
-
Gene name
AQP5
- Application
-
Alternative Names
AQP5;Aquaporin-5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P55064
-
Expression Region
1-265aa
-
AA Sequence
MKKEVCSVAFLKAVFAEFLATLIFVFFGLGSALKWPSALPTILQIALAFG LAIGTLAQALGPVSGGHINPAITLALLVGNQISLLRAFFYVAAQLVGAIA GAGILYGVAPLNARGNLAVNALNNNTTQGQAMVVELILTFQLALCIFAST DSRRTSPVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSFGPAVVMNRFS PAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDEDWE EQREERKKTMELTTR
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AQP5, or Aquaporin 5, is a member of the aquaporin family of integral membrane proteins that facilitate the transport of water and other small solutes across cell membranes. It is predominantly expressed in epithelial tissues, particularly in the salivary glands, lungs, and kidneys, playing a crucial role in water homeostasis and fluid regulation. The study of AQP5 recombinant protein has gained significant attention due to its potential implications in various physiological and pathological processes, including dehydration, pulmonary edema, and dry mouth syndrome. The ability to produce AQP5 in a recombinant form enables researchers to investigate its structure-function relationships, gating mechanisms, and interactions with other cellular components. Additionally, understanding the precise role of AQP5 in cellular water transport can provide insights into its involvement in diseases such as cystic fibrosis and cancer. Employing techniques such as molecular cloning, expression in heterologous systems, and purification methods, researchers aim to characterize the functional properties of AQP5. This research is not only vital for elucidating the physiological roles of AQP5 but also paves the way for potential therapeutic applications, including the development of drugs targeting AQP5 dysregulation. Overall, the study of AQP5 recombinant protein stands at the intersection of molecular biology, biochemistry, and medical research, highlighting its importance in both basic science and clinical applications.











