Cat: PA1000-9243

Recombinant Human AQP5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AQP5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AQP5;Aquaporin-5

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P55064

  • Expression Region

    1-265aa

  • AA Sequence

    MKKEVCSVAFLKAVFAEFLATLIFVFFGLGSALKWPSALPTILQIALAFG LAIGTLAQALGPVSGGHINPAITLALLVGNQISLLRAFFYVAAQLVGAIA GAGILYGVAPLNARGNLAVNALNNNTTQGQAMVVELILTFQLALCIFAST DSRRTSPVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSFGPAVVMNRFS PAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDEDWE EQREERKKTMELTTR

  • Molecular Weight

    31 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

AQP5, or Aquaporin 5, is a member of the aquaporin family of integral membrane proteins that facilitate the transport of water and other small solutes across cell membranes. It is predominantly expressed in epithelial tissues, particularly in the salivary glands, lungs, and kidneys, playing a crucial role in water homeostasis and fluid regulation. The study of AQP5 recombinant protein has gained significant attention due to its potential implications in various physiological and pathological processes, including dehydration, pulmonary edema, and dry mouth syndrome. The ability to produce AQP5 in a recombinant form enables researchers to investigate its structure-function relationships, gating mechanisms, and interactions with other cellular components. Additionally, understanding the precise role of AQP5 in cellular water transport can provide insights into its involvement in diseases such as cystic fibrosis and cancer. Employing techniques such as molecular cloning, expression in heterologous systems, and purification methods, researchers aim to characterize the functional properties of AQP5. This research is not only vital for elucidating the physiological roles of AQP5 but also paves the way for potential therapeutic applications, including the development of drugs targeting AQP5 dysregulation. Overall, the study of AQP5 recombinant protein stands at the intersection of molecular biology, biochemistry, and medical research, highlighting its importance in both basic science and clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US