Analytical Data
-
Gene name
CD40LG
- Application
-
Alternative Names
CD40LG；TNFRSF5；Tumor necrosis factor receptor superfamily member 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P29965
-
Expression Region
113-261aa
-
AA Sequence
MQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLT VKRQGLYYIYAQVTFCSNREASSQAPFIASLCLKSPGRFERILLRAANTH SSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKL
-
Molecular Weight
16 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD40LG (CD40 ligand) recombinant protein has garnered significant interest in immunology and therapeutic research due to its pivotal role in the regulation of immune responses. CD40LG, primarily expressed on activated CD4+ T cells, interacts with CD40 on antigen-presenting cells (APCs), facilitating crucial signals for immune activation, proliferation, and differentiation of B cells. This interaction enhances the production of antibodies and promotes the development of memory B cells, thus playing a vital role in both humoral and cellular immunity. Dysregulation of the CD40-CD40LG pathway is implicated in various autoimmune diseases, cancers, and infectious diseases, highlighting the potential for CD40LG as a therapeutic target. Recombinant forms of CD40LG have been developed for use in research and clinical applications, aiding in the study of immune mechanisms, vaccine development, and the generation of monoclonal antibodies. The growing body of evidence supporting the therapeutic modulation of this pathway underscores its importance in creating effective immunotherapies and enhancing vaccine responses, making CD40LG recombinant protein a valuable tool in advancing our understanding of immune system dynamics and developing novel treatment strategies.
