Analytical Data
-
Gene name
TNFRSF5
- Application
-
Alternative Names
TNFRSF5；TNFRSF5；Tumor necrosis factor receptor superfamily member 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P25942
-
Expression Region
21-193aa
-
AA Sequence
EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
-
Molecular Weight
48.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TNFRSF5, also known as CD40, is a member of the tumor necrosis factor receptor superfamily, playing a crucial role in immune responses, B cell activation, and T cell interactions. It is predominantly expressed on antigen-presenting cells, including B cells, dendritic cells, and macrophages, where its engagement with the ligand CD40L (CD154) triggers a series of intracellular signaling pathways that promote cell survival, proliferation, and differentiation. The significance of TNFRSF5 in both adaptive immunity and immunological disorders such as autoimmune diseases and cancers has generated substantial interest in the development of recombinant CD40 proteins for therapeutic applications. Research has shown that manipulating CD40-CD40L interactions can enhance immune responses in vaccine development, promote antitumor effects, and modulate the immune microenvironment. Additionally, the study of TNFRSF5 recombinant proteins provides insights into its structure-function relationship, aiding in the design of targeted therapies that can improve immune system targeting of malignancies. Given the potential of CD40 as a therapeutic target, ongoing investigations focus on optimizing its recombinant forms for clinical applications, elucidating the mechanisms underlying its signaling pathways, and exploring its potential in combination therapies to enhance anti-tumor immunity and overcome immune evasion strategies employed by cancer cells.
